Go to page of
Similar user manuals
-
Stereo Receiver
Onkyo TX TX-SR606
2 pages 0.6 mb -
Stereo Receiver
Onkyo TX-NR801
96 pages 5.06 mb -
Stereo Receiver
Onkyo SKR-3600
8 pages 4.9 mb -
Stereo Receiver
Onkyo SKC-960C
112 pages 4.12 mb -
Stereo Receiver
Onkyo TX-SR303E
56 pages 1.84 mb -
Stereo Receiver
Onkyo TX-NR900E
84 pages 2.89 mb -
Stereo Receiver
Onkyo TX-SR602/602E
96 pages 14.17 mb -
Stereo Receiver
Onkyo TX-NR737
93 pages 16.35 mb
A good user manual
The rules should oblige the seller to give the purchaser an operating instrucion of Onkyo HT-R693, along with an item. The lack of an instruction or false information given to customer shall constitute grounds to apply for a complaint because of nonconformity of goods with the contract. In accordance with the law, a customer can receive an instruction in non-paper form; lately graphic and electronic forms of the manuals, as well as instructional videos have been majorly used. A necessary precondition for this is the unmistakable, legible character of an instruction.
What is an instruction?
The term originates from the Latin word „instructio”, which means organizing. Therefore, in an instruction of Onkyo HT-R693 one could find a process description. An instruction's purpose is to teach, to ease the start-up and an item's use or performance of certain activities. An instruction is a compilation of information about an item/a service, it is a clue.
Unfortunately, only a few customers devote their time to read an instruction of Onkyo HT-R693. A good user manual introduces us to a number of additional functionalities of the purchased item, and also helps us to avoid the formation of most of the defects.
What should a perfect user manual contain?
First and foremost, an user manual of Onkyo HT-R693 should contain:
- informations concerning technical data of Onkyo HT-R693
- name of the manufacturer and a year of construction of the Onkyo HT-R693 item
- rules of operation, control and maintenance of the Onkyo HT-R693 item
- safety signs and mark certificates which confirm compatibility with appropriate standards
Why don't we read the manuals?
Usually it results from the lack of time and certainty about functionalities of purchased items. Unfortunately, networking and start-up of Onkyo HT-R693 alone are not enough. An instruction contains a number of clues concerning respective functionalities, safety rules, maintenance methods (what means should be used), eventual defects of Onkyo HT-R693, and methods of problem resolution. Eventually, when one still can't find the answer to his problems, he will be directed to the Onkyo service. Lately animated manuals and instructional videos are quite popular among customers. These kinds of user manuals are effective; they assure that a customer will familiarize himself with the whole material, and won't skip complicated, technical information of Onkyo HT-R693.
Why one should read the manuals?
It is mostly in the manuals where we will find the details concerning construction and possibility of the Onkyo HT-R693 item, and its use of respective accessory, as well as information concerning all the functions and facilities.
After a successful purchase of an item one should find a moment and get to know with every part of an instruction. Currently the manuals are carefully prearranged and translated, so they could be fully understood by its users. The manuals will serve as an informational aid.
Table of contents for the manual
-
Page 1
En Fr Es HT-R693 A V RECEIVER Basic Manual Advanced Manual found here http:/ /www .onkyo .c om/manual /htr 693/ adv/en.h tml E n[...]
-
Page 2
Bef ore Star t 2 About the Basic Manual The Basic Manual leads you through the fundamental steps to enjoy the A V Receiver from connections to TV , speaker system and playbac k components, to necessary functions for pla yback. As well as that, Basic Manual inf or ms you with the instructions on frequently used functions. Besides, there is another p[...]
-
Page 3
Step 1: Connections 3 1 Connecting the TV and pla yers Important : The power cord must be connected only after all other connections are completed. HDMI cable connection The unit has many HDMI jac ks on its rear panel and each of them corresponds to an input selector button of the same name on the front panel. F or example, a Blu-r ay Disc play er [...]
-
Page 4
4 Step 1: Connections r T o enjo y HDCP2.2 protected video , connect the play er to the HDMI IN3 jack and the TV to the HDMI OUT MAIN jack of the unit. Y our pla yer and TV need to suppor t HDCP2.2. r T o pla y 4K or 1080p video , use the high speed HDMI cable . r Another TV can be connected to the HDMI OUT SUB jack. T o use the function t[...]
-
Page 5
5 Step 1: Connections 2 Connecting speakers Speaker lay out # $ % & ' " " # Dolby Enab led Speakers (F ront) $ Center speakers % & Surround speakers ' Subwoof er r T o use the multi-zone function, see the section 6 "Using the multi-zone function" of "Step 3: Pla ying Back". Dolby Enab led Speakers [...]
-
Page 6
6 Step 1: Connections Cut and remov e the plastic coating from the end of the speaker cab le, twist the core and connect it to the terminal. Make correct connection between the unit's jac ks and speaker's jac ks (+ to + and - to -) for each channel. If connection is wrong, a bass sound may become poor due to rev erse phase. ¼ The spe[...]
-
Page 7
7 Step 2: Setting Up Important : When the unit is turned on for the first time , the setup wizard of the section 2 will automatically be launched. If you use the setup wizard to mak e the initial setup, connect a TV to the HDMI OUT MAIN jack of the unit via HDMI connection. 1 T urning the power on Connect the power cord to the outlet. Press z ON/ST[...]
-
Page 8
8 Step 2: Setting Up 2. After placing the microphone at the measurement position, select "Do it Now" with the cursor s and press ENTER. 3. Connect the microphone to the SETUP MIC jac k of the unit. SETUP MIC jack Speaker setup microphone 4. Follow the guidance displa yed on the TV screen. AccuEQ Room Calibration Front Speakers Type Height[...]
-
Page 9
9 Step 2: Setting Up 4th Step : Network Connection Do you want to connect network connection? It gives you network services that our A V receiver support. If you wish to skip this step. select “No. Skip”. Yes No. Skip HOM E Ex it Initial Setup Network Connection Y ou can check the network connection and make the Wi-Fi setting. When the Netw[...]
-
Page 10
Step 3: Pla ying Bac k 10 1 Playing the pla yer and TV z T o control the unit : The remote controller of this unit has the remote mode function for controlling other de vices. Y ou cannot control this unit when the remote controller is in the remote mode other than RECEIVER mode (for controlling this unit). Be sure to press 2 RCV to select the RECE[...]
-
Page 11
11 Step 3: Pla ying Back Listening modes Y ou can select a listening mode from various options such as Dolby Digital, Dolb y Atmos and DTS. Select the desired mode by s witching and listening actual sound in different modes. The selectab le listening modes depend on the format of the input signals. MO VIE/TV : Y ou can select a listening mode suita[...]
-
Page 12
12 Step 3: Pla ying Back 3 Connecting and playing the Bluetooth- enabled device Y ou can wirelessly enjoy music files stored in a smartphone or QVJGT$NWGVQQVJGPCDNGFFG XKEG 6JGEQ XGTCIGCTGCKU|H GGV (15 meters). r The Bluetooth-enabled de vice needs to suppor t the A2DP profile. r Note that connection is not[...]
-
Page 13
13 Step 3: Pla ying Back USB : Select "USB" in the TV screen and connect a USB storage de vice to the USB por t on the front panel. On the TV screen, select the desired folder or m usic file with the cursors of the remote controller and press ENTER to confirm and star t playback. r "USB" becomes selectable after the USB f[...]
-
Page 14
14 Step 3: Pla ying Back 6 Using the multi-zone function Y ou can multi-zone connect the unit with an integrated amplifier and speakers in a separate room and pla y sound from an external de vice connected to the analog audio input jacks of the unit, sound from the "NET", "USB" or "BLUET OOTH" source , and the AM/FM br[...]
-
Page 15
15 1 24 9 F G H I K 6 L 3 57 8 J N M R ST P Q O (European model) (European model) Front P anel 1 z ON/ST ANDBY button : T ur ns the unit on or into standby mode . 2 BLUET OOTH indicator : Flashes while pair ing with a Bluetooth-enabled de vice is in progress and sta ys lit when pairing is completed. 3 Wi-Fi indicator : Lights when the unit is conne[...]
-
Page 16
16 1 46 8 2 3 5 7 FG 9 H I Rear P anel 1 RI REMO TE CONTROL jack : An Onkyo product with RI jack can be connected and synchroniz ed with this unit. 2 #06'00##/(/ŝVGTOKPCN : The supplied antennas are connected. 3 COMPONENT VIDEO IN/OUT jacks : Component video input/output jacks 4 ETHERNET port : Used f or Ethernet conne[...]
-
Page 17
17 T r oub leshooting Before starting the procedure Problems ma y be solved by simply turning the power on/off or disconnecting/connecting the power cord, which is easier than working on the connection, setting and operating procedure. T ry the simple measures on both the unit and the connected device . If the problem is that the video or audio is [...]
-
Page 18
18 Specifications Amplifier Section Rated Output Po wer All channels: 95 watts minimum continuous po wer per channel, 8 ohm loads, 2 channels driven from 20 Hz to 20 kHz, with a maximum total harmonic distortion of 0.08% (FTC) 115 watts minimum continuous po wer per channel, 6 ohm loads, |EJCPPGNUFTKXGPCVM* YKVJCOCZKO[...]
-
Page 19
19 Other s License and T rademark Information Manufactured under license from Dolb y Laboratories. Dolby , Dolby Atmos, Dolby Surround, Surround EX and the double-D symbol are tr ademarks of Dolby Laboratories. For DTS patents , see http://patents.dts.com. Manufactured under license from DTS Licensing Limited. DTS, DTS-HD , the Symbol, & DTS an[...]
-
Page 20
20 – P or la presente, Onkyo Corporation, declara que este HT -R693 cumple con los requisitos esenciales y otras exigencias rele vantes de la Directiv a 1999/5/EC. – P ar la présente, Onkyo Corporation déclare que l’appareil HT -R693 est conforme aux exigences essentielles et aux autres dispositions pertinentes de la directive 1999/5/CE. ?[...]
-
Page 21
HT-R693 A V RECEIVER Mode d'Emploi Base Mode d'Emploi A vancé trouvé ici http:/ /www .onkyo . com/manual/htr69 3/adv/ fr .html F r[...]
-
Page 22
A v ant de démarrer 2 A propos du mode d'emploi simplifié Le mode d'emploi simplifié vous guide à tr avers les étapes fondamentales , afin d'utiliser le récepteur A V depuis les connexions de la TV , du système d'enceintes et des composants d'écoute, aux f onctions nécessaires pour l'écoute. De cette façon, [...]
-
Page 23
Étape 1 : Conne xions 3 1 Connexion du télé viseur et des lecteurs Important : Le cordon d'alimentation doit être connecté uniquement lorsque toutes les autres connexions sont eff ectuées. Connexion du câble HDMI L'appareil a beaucoup de prises HDMI sur son panneau arrière et chacune d'entre elles correspond à un sélecteur [...]
-
Page 24
4 Étape 1 : Conne xions r P our pouvoir profiter de la vidéo protégée HDCP2.2, connectez le lecteur à la prise HDMI IN3 et le téléviseur à la prise HDMI OUT MAIN de l'appareil. V otre lecteur et votre télé viseur doivent être compatib les av ec HDCP2.2. r P our lire des vidéos de 4K ou de 1080p , utilisez le câble HDMI haute[...]
-
Page 25
5 Étape 1 : Conne xions 2 Connexion des enceintes Disposition de l'enceinte # $ % & ' " " # Enceintes Dolby Activ é (Av ant) $ Enceintes centrales % & Enceintes ambiophoniques ' Caisson de basse r P our utiliser la fonction multi-z one, voir la section 6 |7VKNKUCVKQPFGNCHQPEVKQPO WNVKQPG|?[...]
-
Page 26
6 Étape 1 : Conne xions Découpez et retirez la gaine plastique à l'extrémité du câble de l'enceinte , torsadez son cœur et connectez -le à la borne. Connectez correctement les prises de l'appareil et les prises de l'enceinte (+ avec + et - a vec -) pour chaque canal. Si une conne xion est mauvaise, un son g rav e peut se[...]
-
Page 27
7 Étape 2 : Installation Important : Lorsque l'appareil est mis sous tension pour la première fois , l'assistant d'installation de la section 2 sera automatiquement lancé. Si vous utilisez l'assistant d'installation pour effectuer la configur ation initiale, connectez un téléviseur à la prise HDMI OUT MAIN de l'a[...]
-
Page 28
8 Étape 2 : Installation 2. Après av oir placé le microphone à la position de OGUWTGUÅNGEVKQPPG|&QKV0Q Y¼NCKFGFGU curseurs, puis appuyez sur ENTER. 3. Connectez le microphone à la prise SETUP MIC de l'appareil. Prise SETUP MIC Micro de paramétrage d'enceinte 4. S uivez les instructions a[...]
-
Page 29
9 Étape 2 : Installation VJ5VGR 0GVYQTM%QPPGEVKQP Do you want to connect network connection? It gives you network services that our A V receiver support. If you wish to skip this step. select “No. Skip”. Yes No. Skip HOM E Ex it Initial Setup Network Connection V ous pouvez vérifier la conne xion au réseau et effectu[...]
-
Page 30
Étape 3 : Écouter 10 1 Lecture à partir du lecteur et le téléviseur z P our commander l'appareil : La télécommande de cet appareil est doté d'une fonction mode de télécommande pour contrôler d'autres appareils. V ous ne pouvez pas contrôler l’appareil lorsque la télécommande est en mode de télécommande autre que le [...]
-
Page 31
11 Étape 3 : Écouter Modes d'écoute V ous pouvez choisir un mode d'écoute à par tir de plusieurs options comme le Dolby Digital, Dolb y Atmos et DTS. Sélectionnez le mode choisi en commutant et en écoutant le son en temps réel dans différents modes . Les modes d'écoute sélectionnables dépendent du f ormat des signaux d&ap[...]
-
Page 32
12 Étape 3 : Écouter 3 Connexion et lecture du son du dispositif compatible Bluetooth V ous pouvez profiter sans fil des fichiers musicaux stoc kés dans votre smartphone ou autre périphér ique compatible Bluetooth. La zone de couv er ture est de 48 pieds (15 mètres). r Le périphérique compatible Bluetooth a besoin d'être compatible[...]
-
Page 33
13 Étape 3 : Écouter USB 5ÅNGEVKQPPG75$UWTNÅETCPFGNC 68GVEQPPGEVGWP périphérique de stockage USB sur le por t USB situé sur le panneau av ant. Sur l'écran de la TV , sélectionnez le dossier de votre choix ou un fichier musical av ec les curseurs de la télécommande et appuyez [...]
-
Page 34
14 Étape 3 : Écouter 6 Utilisation de la fonction m ulti-zone V ous pouvez connecter l'appareil en multi-zone a vec un amplificateur intégré et des enceintes dans une pièce séparée et lire le son depuis un périphérique externe connecté aux pr ises FGPVTÅGCWFKQCPCNQIKSWGFGNCRRCTGKNFGRWKU|0'6|Q[...]
-
Page 35
15 1 24 9 F G H I K 6 L 3 57 8 J N M R ST P Q O (Modèles européens) (Modèles européens) P anneau frontal 1 Bouton z 1056 #0&$; P er met la mise en marche ou veille de l'appareil. 2 T émoin BLUET OO TH : Clignote lorsque le jumelage av ec un périphér ique compatible Bluetooth est en cours et reste allumé lorsque le jumelage[...]
-
Page 36
16 1 46 8 2 3 5 7 FG 9 H I P anneau arrière 1 Prise RI REMO TE CONTROL : Un produit Onkyo a vec une prise RI peut être connecté et synchronisé avec cet appareil. 2 $QTPG#06'00##/(/ŝ : Les antennes fournies sont connectées. 3 Prises COMPONENT VIDEO IN/OUT : Prises vidéo composante entrée/sor tie 4 P or t ETHER[...]
-
Page 37
17 Dépannage A vant de démarrer la procédure Les problèmes peuv ent être résolus simplement en allumant et en coupant l'alimentation, ou en débranchant/rebranchant le cordon d'alimentation, ce qui est plus facile que de tr availler sur la conne xion, la procédure de paramétrage et de f onctionnement. Essay ez d'effectuer les[...]
-
Page 38
Caractéristiques techniques 18 P ar tie de l'amplificateur Puissance de sortie nominale 6 QWVGUNGUEJCÊPGU YCVVUOKPKOWOFGRWKUUCPEGGPEQPVKPWRCTEJCÊPG QJOFG EJCTIG ECPCWZCNNCPVFG*¼M*CXGEWPOCZKO WOFG FKUVQTUK[...]
-
Page 39
19 A utres Informations relatives à la licence et à la mar que commerciale F abriqué sous licence de Dolby Laboratories. Dolby , Dolby Atmos, Dolby Surround, Surround EX et le symbole double-D sont des marques commerciales de Dolby Laboratories. P our les brevets DTS , voir http://patents.dts.com. Fabriqué sous licence de DTS Licensing Limited.[...]
-
Page 40
20 Prècautions Modèles pour l’Europe Déclaration de Conf ormité Nous déclarons, sous notre seule responsabilité, que le produit est conforme aux normes : – Sécurité – Limites et méthodes de mesure des caractéristiques des per turbations radioélectriques – Limites pour les émissions de courant harmonique – Limitation des v aria[...]
-
Page 41
E s HT-R693 A V RECEIVER Manual Básico Aquí encontrará el Manual A vanzado http:/ /www .onkyo . com/manual /htr 693/ adv/es.h tml[...]
-
Page 42
Antes de empezar 2 Acerca del Man ual básico El Manual básico lo guía a tra vés de los pasos fundamentales para disfrutar del Receptor de A V desde las cone xiones a la TV , sistemas de altav oces y componentes de reproducción, hasta las funciones necesarias para la reproducción. A par te de eso , el Manual básico le inf or ma con las instru[...]
-
Page 43
Paso 1: Cone xiones 3 1 Conexión de la TV y de los reproductores Importante : El cab le de alimentación debe conectarse sólo después de que todas las otras cone xiones se hay an completado . Conexión de cable HDMI La unidad tiene muchos conectores HDMI en su panel trasero y cada uno de ellos corresponde a un botón del selector de entrada del [...]
-
Page 44
4 Paso 1: Cone xiones en “P aso 2: Configuración”. r P ara disfrutar del vídeo protegido con HDCP2.2, conecte el reproductor al conector HDMI IN3 y a la TV en el conector HDMI OUT MAIN de la unidad. Su reproductor y la TV tienen que ser compatibles con HDCP2.2. r P ara reproducir vídeo de 4K o 1080p , use un cable HDMI de alta velocida[...]
-
Page 45
5 Paso 1: Cone xiones 2 Conexión de alta voces Disposición de los altav oces # $ % & ' " " # Altav oces habilitados con Dolby (Delanteros) $ Altav oces centrales % & Altav oces envolv entes ' Subwoof er r P ara utilizar la función multizona, consulte la sección 6 “Uso de la función m ultizona” del “P aso 3:[...]
-
Page 46
6 Paso 1: Cone xiones Cor te y quita la cubier ta de plástico del extremo del cab le del altav oz, gire el núcleo y conéctelo al terminal. Realice una conexión correcta entre las conexiones de la unidad y las cone xiones del altav oz (+ a + y - a -) para cada canal. Si la cone xión está mal, un sonido bajo puede volv erse pobre debido a una f[...]
-
Page 47
7 Paso 2: Configuración Importante : Cuando se enciende por primera v ez la unidad, se abrirá automáticamente el asistente de configuración de la sección 2. Si usa el asistente de configuración para realizar la configuración inicial, conecte una TV al conector HDMI OUT MAIN de la unidad a trav és de una conexión HDMI. 1 Encendiendo la unid[...]
-
Page 48
8 Paso 2: Configuración 2. Después de colocar el micróf ono en la posición de medición, seleccione “Do it Now” con los cursores y pulse ENTER. 3. Conecte el micróf ono al conector SETUP MIC de la unidad. Conector SETUP MIC Micrófono para la configuración de altav oces 4. Siga la guía mostrada en la pantalla de la TV . AccuEQ Room Calib[...]
-
Page 49
9 Paso 2: Configuración 4th Step : Network Connection Do you want to connect network connection? It gives you network services that our A V receiver support. If you wish to skip this step. select “No. Skip”. Yes No. Skip HOM E Ex it Initial Setup Network Connection Puede comprobar la conexión de red y realizar la configuración Wi-Fi. Cua[...]
-
Page 50
Paso 3: Repr oducción 10 1 Reproducción del repr oductor y la TV z Para contr olar la unidad : El mando a distancia de esta unidad tiene la función de modo remoto para controlar otros dispositivos . No puede controlar esta unidad si el mando a distancia está en un modo remoto que no sea el modo RECEIVER (para controlar esta unidad). Asegúrese [...]
-
Page 51
11 Paso 3: Reproducción Modos de audición Puede seleccionar un modo de audición entre varias opciones, como Dolb y Digital, Dolby Atmos y DTS. Seleccione el modo deseado cambiando y escuchando sonido real en diferentes modos . Los modos de audición seleccionables dependen del formato de las señales de entrada. MO VIE/TV : Puede seleccionar un [...]
-
Page 52
12 Paso 3: Reproducción 3 Conexión y repr oducción del dispositivo habilitado con Bluetooth Puede disfrutar de archivos de música almacenados en un teléfono inteligente u otros dispositiv os con Bluetooth de forma inalámbrica. El área de cober tura es de 48 pies (15 metros). r Los dispositivos compatib les con Bluetooth deben ser compatib[...]
-
Page 53
13 Paso 3: Reproducción USB : Seleccione “USB” en la pantalla de la TV y conecte un dispositivo de almacenamiento USB en el puerto USB del panel frontal. En la pantalla de la TV , seleccione la car peta o el archivo de música deseados con los cursores del mando a distancia y pulse ENTER para confirmar e iniciar la reproducción. r “U[...]
-
Page 54
14 Paso 3: Reproducción 6 Uso de la función multizona Puede conectar en múltiples zonas la unidad con un amplificador integrado y alta voces en una habitación separada y reproducir el sonido desde un dispositivo e xterno conectado a los conectores de entrada de audio analógico de la unidad, desde la fuente “NET”, “USB” o “BLUET OO TH[...]
-
Page 55
15 1 24 9 F G H I K 6 L 3 57 8 J N M R ST P Q O (European model) (European model) Front P anel 1 Botón z ON/ST ANDBY : Enciende la unidad o la pone en modo de espera. 2 Indicador BLUET OOTH : Parpadea mientras el emparejamiento con un dispositivo compatib le con Bluetooth está en curso y permanece iluminado cuando el emparejamiento se ha completa[...]
-
Page 56
16 1 46 8 2 3 5 7 FG 9 H I P anel trasero 1 Conector RI REMO TE CONTROL : Un producto Onkyo con un conector RI puede ser conectado y sincronizado con esta unidad. 2 6 GTOKPCN#06'00##/(/ŝ : Las antenas suministradas están conectadas. 3 Conectores COMPONENT VIDEO IN/OUT : Cone xiones de entrada/salida de vídeo por comp[...]
-
Page 57
17 Resolución de pr oblemas Antes de iniciar el procedimiento El problema puede solucionarse simplemente encendiendo y apagando la alimentación o desconectando/conectando el cable de alimentación, lo cual es más sencillo que el procedimiento de conexión, ajuste y oper ación. Intente las medidas simples tanto en la unidad como en el dispositiv[...]
-
Page 58
Especificaciones 18 Sección del amplificador Potencia de salida nominal T odos los canales: 95 vatios mínimo de potencia continua por canal, cargas de |QJOKQUECPCNGUCEVKX QUGPVTG*[M*EQPWPO½ZKOQ total de distorsión armónica de 0,08% (FTC) 115 vatios mínimo de potencia continua po[...]
-
Page 59
19 Other s Información sobre licencias y mar cas comerciales F abricado bajo la licencia de Dolby Laboratories. Dolby , Dolby Atmos, Dolby Surround, Surround EX y el símbolo de doble D son marcas comerciales de Dolby Laboratories. Par a las patentes DTS, consulte http://patents.dts.com. F abricado bajo la licencia de DTS Licensing Limited. DTS, D[...]
-
Page 60
Precauciones P ara los Modelos Europeos Declaración de Conf ormidad Declaramos, bajo nuestr a total responsabilidad, que este producto cumple con las normas: – Seguridad – Límites y métodos de medición de las caracteísticas de perturbación radioeléctrica – Límites de las emisiones harmónicas vigentes – Limitación de los cambios de[...]
-
Page 61
Support for Spotify Connect Spotify Connect can be suppor ted by updating the unit's firmware. Simply clic k the Connect icon and select the unit on the playbac k screen of Spotify application to enjoy high quality music streaming. T o enable Spotify Connect, install the Spotify application on your smartphone or tablet first. Then, cre[...]
-
Page 62
Unterstützung für Spotify Connect Spotify Connect kann durch Aktualisierung der Fir mware des Geräts unterstützt werden. Klicken Sie einf ach auf das Symbol Connect und wählen Sie das Gerät auf dem Wiedergabe-Bildschir m der Anwendung Spotify , um hochqualitatives Musik-Streaming zu genießen. Zur Aktivierung von Spotify Connect, inst[...]
